PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_37843.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 164aa    MW: 17627.2 Da    PI: 4.126
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_37843.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM44.55e-14154697128
           NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++g+kktLv+y+grap+g++tdWvmheyrl
  MLOC_37843.2  15 ARAIGMKKTLVYYRGRAPQGVRTDWVMHEYRL 46 
                   5679**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100521.739169IPR003441NAC domain
SuperFamilySSF1019411.83E-191470IPR003441NAC domain
PfamPF023651.2E-61546IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MTQQHHGGGG SGGGARAIGM KKTLVYYRGR APQGVRTDWV MHEYRLDDKD SEDTIAIQDT  60
YALCRVFKKN AICAEVEELQ EGQCSMALLE GACQQLLAAG SRTTAGQEYY QTPSPDVPAG  120
STSGGADPDA EDDDADKDDS WMQFISEDAW CSSTVAEEST SCVA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2514930.0AK251493.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf127o16, mRNA sequence.
GenBankAK3595070.0AK359507.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1098E06.
GenBankAK3610300.0AK361030.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1130O02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006661516.24e-73PREDICTED: NAC domain-containing protein 92-like
RefseqXP_008653037.13e-74PREDICTED: NAC domain-containing protein 74-like
TrEMBLM0VW931e-119M0VW93_HORVD; Uncharacterized protein
STRINGMLOC_37843.11e-117(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.17e-42NAC domain containing protein 57